Presentasi sedang didownload. Silahkan tunggu

Presentasi sedang didownload. Silahkan tunggu

PERANCANGAN PENGORGANISASIAN DAN PENGOLAHAN DATA SURVEI KONSUMSI PANGAN.

Presentasi serupa


Presentasi berjudul: "PERANCANGAN PENGORGANISASIAN DAN PENGOLAHAN DATA SURVEI KONSUMSI PANGAN."— Transcript presentasi:

1 PERANCANGAN PENGORGANISASIAN DAN PENGOLAHAN DATA SURVEI KONSUMSI PANGAN

2 NutritionalAssessmentSystemNutritionalAssessment System Nutritionalassessment: Nutritional assessment: Theinterpretationofinformationfromdietary,laboratory,anthropometric andclinicalstudies The interpretation of information from dietary, laboratory, anthropometric and clinical studies +NutritionalAssessmentSystems:+ Nutritional Assessment Systems: –Survei(Surveys)– Survei (Surveys) –Surveilen(Surveillance)– Surveilen (Surveillance) –Skrining(Screening)– Skrining (Screening) –Intervensi(Intervention)– Intervensi (Intervention)

3 1. Survei1. Survei +Digunakanuntukmenentukandatadasar(database)gizi dan/ataumenentukanstatusgizikelompokpopulasi tertentu/menyeluruh,dgncarasurveicross-sectional. + Digunakan untuk menentukan data dasar (database) gizi dan/atau menentukan status gizi kelompok populasi tertentu/menyeluruh, dgn cara survei cross-sectional. +Dapatjugadigunakanuntukmengidentifikasidan mendiskripsikansubkelompokpopulasiyang“atrisk”thd malnutrisikronik + Dapat juga digunakan untuk mengidentifikasi dan mendiskripsikan sub kelompok populasi yang “at risk” thd malnutrisi kronik +Hasilsurveigizinasionaldapatbergunauntuk mengalokasikansumberdayapadakelompokyang membutuhkandanuntukmemformulasikankebijakanbagi peningkatanstatusgizipadakeseluruhanpopulasi + Hasil survei gizi nasional dapat berguna untuk mengalokasikan sumberdaya pada kelompok yang membutuhkan dan untuk memformulasikan kebijakan bagi peningkatan status gizi pada keseluruhan populasi +Surveijugadapatdigunakanuntukmengevaluasiintervensi gizi dgn membandingkan baseline dan sesudah intervensi + Survei juga dapat digunakan untuk mengevaluasi intervensi gizi dgn membandingkan baseline dan sesudah intervensi

4 Surveilen +Cirikhasyaitumonitoringberkelanjutandaristatus gizi populasitertentu,dimanadatadikumpulkan,dianalisisdan digunakanuntukjangkawaktuyangpanjang,sehinggadapat +Ciri khas yaitu monitoring berkelanjutan dari status gizi populasi tertentu, dimana data dikumpulkan, dianalisis dan digunakan untuk jangka waktu yang panjang, sehingga dapat mengidentifikasipenyebabmalnutrisikronikdanakutmengidentifikasi penyebab malnutrisi kronik dan akut +Hasilsurveilendapatdigunakanuntukmenyusuntindakan intervensi,selainjugadapatdigunakanuntukmemonitor pengaruhkebijakanpemerintahdanmengevaluasiefikasidan efektivitasprogramintervensigizi +Hasil surveilen dapat digunakan untuk menyusun tindakan intervensi, selain juga dapat digunakan untuk memonitor pengaruh kebijakan pemerintah dan mengevaluasi efikasi dan efektivitas program intervensi gizi +ProgramSurveilendiASyangterkenaladalahNationalHealth andNutritionExaminationSurvey(NHANES) +Program Surveilen di AS yang terkenal adalah National Health and Nutrition Examination Survey (NHANES)

5 Skrining (Penapisan)Skrining (Penapisan) +Untukmengidentifikasi individumalnutrisiyang memerlukanintervensi,dengancaramembandingkanhasil pengukuran-pengukuranindividudenganbakurujukan tingkatrisiko(cutoffpoint). +Untuk mengidentifikasi individu malnutrisi yang memerlukan intervensi, dengan cara membandingkan hasil pengukuran- pengukuran individu dengan baku rujukan tingkat risiko (cut off point). +Dapatdilakukanpadaseluruhpopulasi,sub-populasi khususyangberisiko,ataupadaindividu2terpilih. +Dapat dilakukan pada seluruh populasi, sub- populasi khusus yang berisiko, atau pada individu2 terpilih. +Diperlukanalatukuryangsederhana,murah,dancepat untuksasaranskalabesar +Diperlukan alat ukur yang sederhana, murah, dan cepat untuk sasaran skala besar

6 Intervensi GiziIntervensi Gizi + Ditargetkanpadasub-kelompokpopulasiyang‘atrisk’ + Ditargetkan pada sub-kelompok populasi yang ‘at risk’ +Ada3typeintervensigizi:suplementation,fortificationdandietary approaches +Ada 3 type intervensi gizi: suplementation, fortification dan dietary approaches +Monitoringdanevaluasimenjadikomponenesensialpadasemuaprogram intervensigizi +Monitoring dan evaluasi menjadi komponen esensial pada semua program intervensi gizi +Monitoringdigunakanuntukmengukursyaratpelayanan,utilisasi, cakupan,danjugabiayaprogram +Monitoring digunakan untuk mengukur syarat pelayanan, utilisasi, cakupan, dan juga biaya program +Typeevaluasi:+Type evaluasi: –adequacyevaluation:menggunakan‘within-groupdesign’dengan membandingkanantarahasilvstarget. – adequacy evaluation: menggunakan ‘within-group design’ dengan membandingkan antara hasil vs target. –plausibilityevaluation:dgbetween-groupquasiexperimentaldesign(ada kelompokintervensidankontrol),tanparandomisasi – plausibility evaluation: dg between-group quasi experimental design ( ada kelompok intervensi dan kontrol), tanpa randomisasi - Probability evaluation : dengan pengacakan kontrol double blind experimental trials

7 1. Pemilihan metode survei Pertimbangan pemilihan metode : a.Unit pengamatan :  Seluruh populasi negara (Nasional) /kota/kabupaten/ kecamatan  Kelompok penduduk yg homogen  Keluarga  Individu  Kombinasi keluarga + individu atau seluruh penduduk +keluarga.

8 b.Jenis data yang diperlukan : c.Biaya dan fasilitas yang tersedia 2. Data penunjang Baik buruknya tingkat konsumsi pangan sangat banyak faktor yg berpengaruh : a.Ketersediaan pangan b.Daya beli c.Kebiasaan makan d.Budaya e.Cara memasak yang salah

9 Sehingga perlu dikumpulkan data penunjang : Pendapatan Pengeluaran Ju,lah keluarga Agama Pendidikan Keadaan sosial Budidaya pertanian Sanitasi Budaya setempat dll

10 3. Macam dan jumlah sampel Macam sampel  tergantung pada tujuan survei Jumlah sampel dipengaruhi oleh : a.Tujuan survei :  jk tujuan untuk mengetahui diversitas pola konsumsi kelompok  jumlah sampel besar.  Bila sampel dikelompokkan/Kluster  sampel hrs proporsional b.Derajat homogenitas  semakin homogen populasi  sampel semakin sedikit : keluarga cukup.

11 c.Korelasi dengan data lainnya : jika ingin dianalisis korelasi antar data dr kelompok yang sama  sampel harus cukup besar 4. Perioda Waktu Pertimbangan : variasi konsumsi pangan bervariasi sesuai dengan periode tertentu misal musim, mingguan, tahunan, bulan.  paling banyak dipakai : periode satu minggu.

12 5. Tenaga : Pemilihan dan latihan Jenis tenaga peneliti/lapang tergantung dari metode yang digunakan Tenaga wanita umum dipilih utk pengumpulan data SDM yg mpy pengetahuan ttg perencanaan menu/makanan lbh baik Personalitas dan karakter SDM :Periang, komunikasi baik

13 Pelatihan : Maksud dan tujuan survei Seni dan teknik wawancara Macam data yang dibutuhkan dan cara memperolehnya Cara mencek data dan menyempurnakannya Pekerjaan rutin yg hrs dilakukan di lapang. Praktek interview

14 6. Formulir Pancatatan  Mengikuti metode yang digunakan, tabulasi hasil, ruang yg cukup. 7. Pemberitahuan ke masyarakat /perijinan  Penting untuk menjamin keberhasilan survei

15 Metode PSGLangsung: 1.Antropometri: 1. Antropometri: –digunakanuntukmengukurdefisiensigiziberupa penurunantingkatfungsionaldalamjaringan,terutama – digunakan untuk mengukur defisiensi gizi berupa penurunan tingkat fungsional dalam jaringan, terutama untukmengetahuiketidakseimbanganproteindanenergi kronik untuk mengetahui ketidakseimbangan protein dan energi kronik –dapatmengukurmalnutrisisedangsampaiberattetapi tidakdapatmengukurtingkatdefisiensizatgizispesifik, – dapat mengukur malnutrisi sedang sampai berat tetapi tidak dapat mengukur tingkat defisiensi zat gizi spesifik, –kelebihanlaindapatmengukurriwayatgizimasalaluyg tidakdptdilakukandgmetodelain. – kelebihan lain dapat mengukur riwayat gizi masa lalu yg tidak dpt dilakukan dg metode lain.

16 2. MetodeLaboratory,terdiri:BiokimiawidanBiofisik/test fungsional 2. Metode Laboratory, terdiri: Biokimiawi dan Biofisik/test fungsional –MetodeBiokimiawiuntukmengetahuiterjadinyadefisiensi berupaberkurangnyaderajatsimpananzatgizidalamjaringan ataucairantubuh – Metode Biokimiawi untuk mengetahui terjadinya defisiensi berupa berkurangnya derajat simpanan zat gizi dalam jaringan atau cairan tubuh –MetodeBiofisik:pengukuranfungsifisiologis/tingkahlaku yangberkaitandgzatgizitertentu. – Metode Biofisik: pengukuran fungsi fisiologis/tingkah laku yang berkaitan dg zat gizi tertentu. 3.Metodeklinik:3. Metode klinik: –digunakanuntukmendeteksitanda-tandaklinikdantanda anatomiksebagai gejalamalnutrisi,dengancaramelihat riwayatmedisdanpemeriksaanfisik. – digunakan untuk mendeteksi tanda-tanda klinik dan tanda anatomik sebagai gejala malnutrisi, dengan cara melihat riwayat medis dan pemeriksaan fisik.

17 Metode PSG Tidak Langsung:Metode PSG Tidak Langsung: 1. SurveiKonsumsiGizi:1. Survei Konsumsi Gizi: –mengidentifikasitahappertamadaridefisiensigizi, yaituketidakseimbangandiet(dietary inadequacy). –mengidentifikasi tahap pertama dari defisiensigizi, yaitu ketidakseimbangan diet(dietary inadequacy). 2. DataStatistikVital:2. Data Statistik Vital: –mengidentifikasioutcome(berupamorbiditasdan mortalitas)yangdiakibatkanolehdefisiensigizi –mengidentifikasi outcome (berupa morbiditas dan mortalitas) yang diakibatkan oleh defisiensigizi 3. FaktorEkologi:3. Faktor Ekologi: –mengidentifikasifaktornongizi(sosialekonomidan demografi)yangyangdapatmempengaruhistatusgizi individuataumasyarakat –mengidentifikasi faktor non gizi (sosial ekonomi dan demografi) yang yang dapat mempengaruhi status gizi individu atau masyarakat

18 PengelompokanData/IndikatorPengelompokan Data/Indikator +TingkatA(Ekologi) :meteorologi,tanah,air,vegetasi animalitas,demografi,antropologi +Tingkat A (Ekologi) : meteorologi, tanah, air, vegetasi animalitas,demografi,antropologi (Infrastruktur):perhubungan,badan-badanpelayanan masyarakat (Infrastruktur):perhubungan, badan-badan pelayanan masyarakat +TingkatB(Produksi&SD):+Tingkat B (Produksi&SD): tanamanpangan,peternakan,perikanan,ekport- importpangan,cadanganpangan,bahanbakar tanaman pangan, peternakan, perikanan, ekport- import pangan, cadangan pangan, bahan bakar +TingkatC(Income&konsumsi):+Tingkat C (Income & konsumsi): pasar,lapangankerja,pendapatan,konsumsi pangan(kualitas&kuantitas) pasar, lapangan kerja, pendapatan, konsumsi pangan(kualitas & kuantitas) +TingkatD(StatusKesehatan): status gizi dan pola penyakit +Tingkat D (Status Kesehatan): status gizi dan pola penyakit

19 Indikatoryang dibutuhkan survei konsumsi pangan +Tunggal:+ Tunggal : –Total/ratakonsumsienergi,proteindsb – Total/ratakonsumsi energi, protein dsb –Frekuensikonsumsidll – Frekuensi konsumsi dll +Gabungan/Indeks:+ Gabungan/Indeks : –Tingkatkecukupanenergi,proteindsb – Tingkat kecukupan energi, protein dsb +Komposit:+ Komposit: –PPH(PolaPanganHarapan) – PPH (Pola Pangan Harapan)

20 Pengolahan data survei ALATYANGYANGDIBUTUHKANALAT YANG YANG DIBUTUHKAN Daftar KomposisiBahanMakanan (DKBM)Daftar Komposisi Bahan Makanan (DKBM) Daftar KandunganZatGiziMakananJajanan (DKGJ)Daftar Kandungan Zat Gizi Makanan Jajanan (DKGJ) DaftarKonversiBeratMentah-Masak (DKMM)DaftarKonversi Berat Mentah-Masak (DKMM) Daftar KonversiPenyerapanMinyak (DKPM)Daftar Konversi Penyerapan Minyak (DKPM) Daftar UkuranRumahTangga (DURT)Daftar Ukuran Rumah Tangga (DURT)RefuseWaste FAKTORKONVERSIYANGDIBUTUHKAN FAKTOR KONVERSI YANG DIBUTUHKAN –BDD(BeratyangDapatDimakan)– BDD (Berat yang Dapat Dimakan) –URT(UkuranRumahTangga)–URT (Ukuran Rumah Tangga) –KonversiBeratMentahMasak(FaktorF)–Konversi Berat Mentah Masak (Faktor F) –KonversiPenyerapanMinyak(FaktorM)–Konversi Penyerapan Minyak (Faktor M) - Bahan makanan penukar- Bahan makanan penukar

21 MENGHITUNGKANDUNGANZATGIZIMENGHITUNG KANDUNGAN ZAT GIZI KomposisiZatGiziBahanMakanan (KBM): Komposisi Zat Gizi Bahan Makanan (KBM): JmlZatGizi=BeratPangan(g)xjmlzatgizidiDKBM xBdd 100g Jml Zat Gizi = Berat Pangan(g) x jml zat gizi di DKBM x Bdd 100 g KandunganZatGiziMakananJajanan(KGJ): Kandungan Zat Gizi Makanan Jajanan (KGJ): JmlZatGizi=Beratmknjajananx KandunganZatGizidiJml Zat Gizi = Berat mkn jajanan x Kandungan Zat Gizi di BeratmknjajanandiDKGJ Berat mkn jajanandi DKGJ diDKGJ di DKGJ

22 MENGHITUNGTINGKATKECUKUPANGIZI(TKG)MENGHITUNG TINGKAT KECUKUPAN GIZI (TKG) Dihitungdenganrumus:Dihitung dengan rumus: +Kriteria(Depkes,1990): +Kriteria (Depkes, 1990) : –Baik:Baik: >100%AKG>100 % AKG––– Sedang: Kurang: Defisit/Buruk: Sedang : Kurang : Defisit/Buruk : 80–99,9%AKG80 – 99,9 % AKG 70–79,9%AKG70 – 79,9 % AKG <70%AKG<70 % AKG tidakbaiktidak baiktidakbaiktidak baik

23 SKORPOLAPANGANHARAPAN(pph)SKOR POLA PANGAN HARAPAN (pph) +Untukmengetahuikualitaspangandilihatdari keragamannyapolapangan + Untuk mengetahui kualitas pangan dilihat dari keragamannya pola pangan +Biasanyauntukmenilaikualitasdarisisiketersediaan pangan. + Biasanya untuk menilai kualitas dari sisi ketersediaan pangan. +CaraperhitunganskorPPH:+ Cara perhitungan skor PPH: -Kelompokjenispangankedalam8kelompokpangan-Kelompok jenis pangan ke dalam 8 kelompok pangan -Hitungjumlahenergimasing2kelompokpangandg DKBM -Hitung jumlah energi masing2 kelompok pangan dg DKBM -Hitungpersentaseenergimasing2kelppangan terhadaptotalenergiperhari -Hitung persentase energi masing2 kelp pangan terhadap total energi per hari -Skor pola pangan harapan dihitung dengan mengalikan persen energi kelompok pangan dengan bobot skoring

24 Kelompok pangan%KonsumsiBobotPPH+ padi-padianpadi-padian ,50,50,50,5 + umbi-umbianumbi-umbian ,50,50,50,5 + hewanihewanihewanihewani 2,02,02,02,0 + minyak/lemakminyak/lemak ,01,01,01,0 + kacang-kacangankacang-kacangan ,02,02,02,0 + buah/bijiberminyakbuah/biji berminyak ,50,50,50, gulagula ,50,50,50,5 + sayurandanbuahsayuran dan buah ,02,02,02,0 + TOTALTOTALTOTALTOTAL

25 + Skor PPH<78:PPH < 78:segitigasegitigaperungguperunggu + Skor PPH78-88:PPH :segitigasegitigaperakperak + Skor PPH>88:PPH> 88:segitigasegitigaemasemas Kriteria skor PPH

26 Contoh Perhitungan PPH KelompokPangan Energi Proporsi Bobot SkorPPH (Kal) (%) Kelompok Pangan Energi Proporsi Bobot Skor PPH (Kal) (%) (a)(b) (c) (d) (a) (b) (c) (d) 1.Padi-padian 1040,0955,160,527,58 1. Padi-padian 1040,09 55,16 0,5 27,58 2.Umbi-umbian 107,845,720,52,86 2. Umbi-umbian 107,84 5,72 0,5 2,86 3.Hewani 135,137,17214,12 3. Hewani 135,13 7, ,12 4.Minyak/lemak 144,727,6717,67 4. Minyak/lemak 144,72 7,67 1 7,67 5.Biji-bijianMinyak 54,072,870,51,43 5. Biji-bijian Minyak 54,07 2,87 0,5 1,43 6.Kacang-kacangan 172,l6 9,13218,26 6. Kacang-kacangan 172,l6 9, ,26 7.Gula 132,087,000,53,50 7. Gula 132,08 7,00 0,5 3,50 8.Sayuran/buah 101,575,39210,77 8. Sayuran/buah 101,57 5, ,77 Total 1885,66100,00986,20 Total 1885,66 100, ,20


Download ppt "PERANCANGAN PENGORGANISASIAN DAN PENGOLAHAN DATA SURVEI KONSUMSI PANGAN."

Presentasi serupa


Iklan oleh Google